PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_24117
Common NameKK1_025480
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CPP
Protein Properties Length: 744aa    MW: 81005.1 Da    PI: 6.4993
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_24117genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.93.1e-16453490340
            TCR   3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    +k+CnCkkskClk+YCeCfaag++C e C C+dC+Nk 
  C.cajan_24117 453 CKRCNCKKSKCLKLYCECFAAGVYCIEPCACQDCFNKP 490
                    89**********************************96 PP

2TCR50.63.7e-16537575139
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                    ++k+gCnCkks+ClkkYCeC++ g+ Cs +C+Ce+CkN 
  C.cajan_24117 537 RHKRGCNCKKSSCLKKYCECYQGGVGCSISCRCEGCKNA 575
                    589***********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011143.7E-18451492IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.117452577IPR005172CRC domain
PfamPF036381.1E-11454489IPR005172CRC domain
SMARTSM011144.4E-17537578IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11539575IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 744 aa     Download sequence    Send to blast
MDTPERNQIS ATLSKFEDSP VFNYINSLSP IKPVKSVPIS QTFNSLSFSS PPSVFTSPHV  60
SCLKESRFLR RHNPLGTSKP KVSSEDVNKV HSSEETLADS TPEHHNNSSG LQENGDKGIS  120
VRDAPIEISS EHIKFSVELS QDLKYNCGSP GYAPPLCGDE ANSLLELPGV QEGCKTDSVE  180
GEVHIQEMCQ MEPKSEGPEC YWDGLIPDAP DMLIFSPPGE AEAFKGLMHK PLNDIMSMLP  240
HSTMHNGRKM HIVDSVASGS EHEIEPITAT ATDEIQNNLA NVALVTSNPN EKANDQLVSV  300
THRAIRRRCL DFEMANVQRK NSDDNSNTGS STSDGNLQKG NLPGIGLHLN AIAALKDYKG  360
IQIEKLSSGR QLNLPNSTSL QISTSQEHQH LALVPLSSEG DLDLDPLDNG VQPAEDCSQP  420
LAYMASEDFN QNSPRKKRQV QRKLETPGET EGCKRCNCKK SKCLKLYCEC FAAGVYCIEP  480
CACQDCFNKP IHEDTVLQTR KQIESRNPLA FAPKVIRSSD TVPEIGDDPN KTPASARHKR  540
GCNCKKSSCL KKYCECYQGG VGCSISCRCE GCKNAFGRKD GSVPVGLETE TEEAEASDKG  600
LAEKALQKTE DHHDSATVST PLRLSRPMLP LPFSSKGKPP RSFVTTISGS ALFACQKLGK  660
SNSLWSQEAS KHFQTVPDDE MPDILRGDSS PIACSPITCI KTSSPNGKRI SSPNCDMGSS  720
PSRRGGRKLI LQSIPSFPSL TPHP
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003537578.10.0PREDICTED: protein tesmin/TSO1-like CXC 2
TrEMBLA0A151SD750.0A0A151SD75_CAJCA; Protein lin-54 isogeny
STRINGGLYMA11G00920.20.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26193375
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-137TESMIN/TSO1-like CXC 2